10x LL37 5mg (50mg)
Original price was: $890.00.$620.00Current price is: $620.00.
Choose: LL37 5mg (x1 LL37 5mg vial) or LL37 5MG Starter Kit Everything you need to get started straight away! (x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes, x10 alcohol wipes) KEY HIGHLIGHTS Purity: >99% (HPLC Tested) Form: Lyophilised Powder Packaging: Sterile 2ml Vial Intended Use: For
Please note: Discounts do not apply to bulk/10x items.
KEY HIGHLIGHTS
-
Purity: >99% (HPLC Tested)
-
Form: Lyophilised Powder
-
Packaging: Sterile 2ml Vial
-
Intended Use: For laboratory research use only. Not for human consumption.
-
Storage: Store below 25°C, away from light and moisture.
STORAGE & HANDLING
-
Store below 25°C in a dry, dark environment.
-
Keep vial sealed until use.
-
Reconstituted solutions should be handled aseptically.
-
Avoid repeated freeze–thaw cycles.
SOLUBILITY & STABILITY
LL-37 dissolves in sterile bacteriostatic water under laboratory conditions.
The peptide is sensitive to oxidation and prolonged exposure to room temperature; store reconstituted solutions appropriately to maintain stability.
TRUST & LEGITIMACY
-
COA Included: Certificate of Analysis available for each batch.
-
Lab Verified: Tested via HPLC and Mass Spectrometry.
-
Compliance: Manufactured and sold strictly for scientific, research-only use.
DISCLAIMER
This product is intended for laboratory research use only. Not for human consumption, medical use, veterinary applications, or household purposes. The purchaser assumes all responsibility for proper handling.
ATTRIBUTES
| Attribute | Detail |
|---|---|
| CAS Number | 259061-43-9 |
| Purity | >99% (HPLC) |
| Appearance | White Lyophilised Powder |
| Molecular Formula | C₅₂₀H₉₇₂N₁₇₂O₁₆₇ |
| Molecular Weight | ~4493.3 g/mol |
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Form | Lyophilised Powder |
| Packaging | Sterile 2ml Vial |
At NeuroGen Research, we aim to deliver your order quickly, safely, and reliably. All orders are shipped from our Sydney/Melbourne locations via Australia Post Express for fast, tracked delivery.
Shipping Rates
- Free Express Shipping – Orders over $200 AUD
- Flat Rate Express Shipping – $14.95 AUD for orders under $200
Delivery Times
- Metro Areas: 2–4 business days
- Regional Areas: 3–5 business days
Delivery timeframes are estimates provided by Australia Post and may vary depending on your location and seasonal demand.
Dispatch Times
- Orders placed before 12:00 PM AEST are shipped the same business day
- Orders placed after 12:00 PM or on weekends/public holidays will be dispatched the next business day
Tracking Your Order
Once your order has been shipped, you will receive an email with your Australia Post tracking number. You can track your order via the Australia Post website.
International Shipping
We currently ship within Australia and New Zealand only.
Order Issues & Delays
If your order is delayed, lost, or arrives damaged, please contact us within 48 hours of delivery so we can investigate and arrange a replacement if eligible under our Quality Assurance Guarantee.
Intended Use:
This product is intended strictly for qualified laboratory researchers. It is not for human or veterinary consumption and must not be used as a drug, food additive, cosmetic, or household item.
Disclaimer:
This compound is sold for in vitro research and educational purposes only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.
Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. NeuroGen Research and its affiliates are not liable for any misuse or mishandling of this material.
RELATED PRODUCTS
HCG 10000IU
HCG 10000IU (Human Chorionic Gonadotropin) is a high-potency glycoprotein hormone used in laboratory research to study reproductive hormones, testosterone production, and endocrine function. Neurogen Research supplies premium, over 99% pure HCG for research use.
Please note: This product is strictly for in vitro laboratory research and is not intended for human consumption or veterinary use.
NAD+
NAD+ (Nicotinamide Adenine Dinucleotide) is a critical coenzyme studied in cellular biology and longevity research for its essential roles in energy metabolism, sirtuin activation, mitochondrial function, DNA repair, and age-related physiological processes. Neurogen Research supplies premium, >99% HPLC-verified NAD+ for laboratory use.
Please note: This product is strictly for in vitro laboratory research and is not intended for human consumption or veterinary use.
Sermorelin
Sermorelin is a synthetic 29-amino acid peptide analogue of Growth Hormone Releasing Hormone (GHRH 1-29). It is utilized in biochemical and endocrine research to study pituitary stimulation, pulsatile growth hormone secretion, metabolic regulation, and age-related hormonal pathways. Neurogen Research supplies premium, >99% HPLC-verified Sermorelin for laboratory use.
Please note: This product is strictly for in vitro laboratory research and is not intended for human consumption or veterinary use.
Starter Kit
The Neurogen Research Starter Kit is a complete research setup designed for safe and precise peptide reconstitution and administration in laboratory environments. Each kit includes 10 × sterile 1ml 30G insulin syringes, 10 × alcohol swabs, and 1 × 3ml bacteriostatic water vial. Ideal for first-time researchers or new research cycles.
Please note: This kit is strictly for in vitro laboratory research support and is not intended for human consumption or veterinary use.
MOTS-C
MOTS-C is a synthetic (lab-made) research peptide and a 16-amino-acid mitochondrial-derived peptide (MDP): its code comes from the mitochondria, a cell's energy parts. Neurogen Research supplies the MOTS-C peptide across Australia and New Zealand as a freeze-dried powder for in-vitro (test-tube and cell) laboratory research only.
- Purity & testing: above 98% by HPLC (latest batch 98.1%), checked by the independent lab Janoshik, with a Certificate of Analysis per batch
- Sizes: 10mg and 40mg vials, on their own, with a starter kit, or in a 10x bulk pack
- Buy MOTS-C online in Australia and New Zealand: same-day from Sydney before 12pm AEST, free express over $200
Not for human or animal use.
Reviews
Clear filtersThere are no reviews yet.